(data stored in ACNUC7421 zone)

EMBL: CP000948.APAG

CP000948.APAG        Location/Qualifiers
FT   CDS             complement(51229..51606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="ECDH10B_0051"
FT                   /product="protein associated with Co2+ and Mg2+ efflux"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01255"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XC51"
FT                   /protein_id="ACB01255.1"
FT                   /translation="MINSPRVCIQVQSVYIEAQSSPDNERYVFAYTVTIRNLGRAPVQL
FT                   LGRYWLITNGNGRETEVQGEGVVGVQPLIAPGEEYQYTSGAIIETPLGTMQGHYEMIDE
FT                   NGVPFSIDIPVFRLAVPTLIH"
     MINSPRVCIQ VQSVYIEAQS SPDNERYVFA YTVTIRNLGR APVQLLGRYW LITNGNGRET        60
     EVQGEGVVGV QPLIAPGEEY QYTSGAIIET PLGTMQGHYE MIDENGVPFS IDIPVFRLAV       120
     PTLIH                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page