(data stored in ACNUC7421 zone)

EMBL: CP000948.AROM

CP000948.AROM        Location/Qualifiers
FT   CDS             345983..346660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroM"
FT                   /locus_tag="ECDH10B_0347"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01519"
FT                   /protein_id="ACB01519.1"
FT                   /translation="MSASLAILTIGIVPMQEVLPLLTEYIDEDNISHHSLLGKLSREEV
FT                   MAEYAPEAGEDTILTLLNDNQLAHVSRRKVERDLQGVVEVLDNQGYDVILLMSTANISS
FT                   MTARNTIFLEPSRILPPLVSSIVEDHQVGVIVPVEEMLPVQAQKWQILQKSPVFSLGNP
FT                   IHDSEQKIIDAGKELLAKGADVIMLDCLGFHQRHRDLLQKQLDVPVLLSNVLIARLAAE
FT                   LLV"
     MSASLAILTI GIVPMQEVLP LLTEYIDEDN ISHHSLLGKL SREEVMAEYA PEAGEDTILT        60
     LLNDNQLAHV SRRKVERDLQ GVVEVLDNQG YDVILLMSTA NISSMTARNT IFLEPSRILP       120
     PLVSSIVEDH QVGVIVPVEE MLPVQAQKWQ ILQKSPVFSL GNPIHDSEQK IIDAGKELLA       180
     KGADVIMLDC LGFHQRHRDL LQKQLDVPVL LSNVLIARLA AELLV                       225
//

If you have problems or comments...

PBIL Back to PBIL home page