(data stored in ACNUC7421 zone)

EMBL: CP000948.CARA

CP000948.CARA        Location/Qualifiers
FT   CDS             29651..30799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="ECDH10B_0033"
FT                   /product="carbamoyl phosphate synthetase small subunit,
FT                   glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01237"
FT                   /protein_id="ACB01237.1"
FT                   /translation="MIKSALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTD
FT                   PSYSRQIVTLTYPHIGNVGTNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKR
FT                   HNIVAIADIDTRKLTRLLREKGAQNGCIIAGDNPDAALALEKARAFPGLNGMDLAKEVT
FT                   TAEAYSWTQGSWTLTGGLPEAKKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQ
FT                   TSAEDVLKMNPDGIFLSNGPGDPAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGA
FT                   KTVKMKFGHHGGNHPVKDVEKNVVMITAQNHGFAVDEATLPANLRVTHKSLFDGTLQGI
FT                   HRTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIEQYRKTAK"
     MIKSALLVLE DGTQFHGRAI GATGSAVGEV VFNTSMTGYQ EILTDPSYSR QIVTLTYPHI        60
     GNVGTNDADE ESSQVHAQGL VIRDLPLIAS NFRNTEDLSS YLKRHNIVAI ADIDTRKLTR       120
     LLREKGAQNG CIIAGDNPDA ALALEKARAF PGLNGMDLAK EVTTAEAYSW TQGSWTLTGG       180
     LPEAKKEDEL PFHVVAYDFG AKRNILRMLV DRGCRLTIVP AQTSAEDVLK MNPDGIFLSN       240
     GPGDPAPCDY AITAIQKFLE TDIPVFGICL GHQLLALASG AKTVKMKFGH HGGNHPVKDV       300
     EKNVVMITAQ NHGFAVDEAT LPANLRVTHK SLFDGTLQGI HRTDKPAFSF QGHPEASPGP       360
     HDAAPLFDHF IELIEQYRKT AK                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page