(data stored in ACNUC7421 zone)

EMBL: CP000948.CITE

CP000948.CITE        Location/Qualifiers
FT   CDS             complement(588137..589045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="ECDH10B_0576"
FT                   /product="citrate lyase, citryl-ACP lyase (beta) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01739"
FT                   /protein_id="ACB01739.1"
FT                   /translation="MISASLQQRKTRTRRSMLFVPGANAAMVSNSFIYPADALMFDLED
FT                   SVALREKDTARRMVYHALQHPLYRDIETIVRVNALDSEWGVNDLEAVVRGGADVVRLPK
FT                   TDTAQDVLDIEKEILRIEKACGREPGSTGLLAAIESPLGITRAVEIAHASERLIGIALG
FT                   AEDYVRNLRTERSPEGTELLFARCSILQAARSAGIQAFDTVYSDANNEAGFLQEAAHIK
FT                   QLGFDGKSLINPRQIDLLHNLYAPTQKEVDHARRVVEAAEAAAREGLGVVSLNGKMVDG
FT                   PVIDRARLVLSRAELSGIREE"
     MISASLQQRK TRTRRSMLFV PGANAAMVSN SFIYPADALM FDLEDSVALR EKDTARRMVY        60
     HALQHPLYRD IETIVRVNAL DSEWGVNDLE AVVRGGADVV RLPKTDTAQD VLDIEKEILR       120
     IEKACGREPG STGLLAAIES PLGITRAVEI AHASERLIGI ALGAEDYVRN LRTERSPEGT       180
     ELLFARCSIL QAARSAGIQA FDTVYSDANN EAGFLQEAAH IKQLGFDGKS LINPRQIDLL       240
     HNLYAPTQKE VDHARRVVEA AEAAAREGLG VVSLNGKMVD GPVIDRARLV LSRAELSGIR       300
     EE                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page