(data stored in ACNUC7421 zone)

EMBL: CP000948.CITF

CP000948.CITF        Location/Qualifiers
FT   CDS             complement(586594..588126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citF"
FT                   /locus_tag="ECDH10B_0575"
FT                   /product="citrate lyase, citrate-ACP transferase (alpha)
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01738"
FT                   /protein_id="ACB01738.1"
FT                   /translation="MTQKIEQSQRQERVAAWNRRAECDLAAFQNSPKQTYQAEKARDRK
FT                   LCANLEEAIRRSGLQDGMTVSFHHAFRGGDLTVNMVMDVIAKMGFKNLTLASSSLSDCH
FT                   APLVEHIRQGVVTRIYTSGLRGPLAEEISRGLLAEPVQIHSHGGRVHLVQSGELNIDVA
FT                   FLGVPSCDEFGNANGYTGKACCGSLGYAIVDADNAKQVVMLTEELLPYPHNPASIEQDQ
FT                   VDLIVKVDRVGDAAKIGAGATRMTTNPRELLIARSAADVIVNSGYFKEGFSMQTGTGGA
FT                   SLAVTRFLEDKMRSRDIRADFALGGITATMVDLHEKGLIRKLLDVQSFDSHAAQSLARN
FT                   PNHIEISANQYANWGSKGASVDRLDVVVLSALEIDTQFNVNVLTGSDGVLRGASGGHCD
FT                   TAIASALSIIVAPLVRGRIPTLVDNVLTCITPGSSVDILVTDHGIAVNPARPELAERLQ
FT                   EAGIKVVSIEWLRERARLLTGEPQPIEFTDRVVAVVRYRDGSVIDVVHQVKE"
     MTQKIEQSQR QERVAAWNRR AECDLAAFQN SPKQTYQAEK ARDRKLCANL EEAIRRSGLQ        60
     DGMTVSFHHA FRGGDLTVNM VMDVIAKMGF KNLTLASSSL SDCHAPLVEH IRQGVVTRIY       120
     TSGLRGPLAE EISRGLLAEP VQIHSHGGRV HLVQSGELNI DVAFLGVPSC DEFGNANGYT       180
     GKACCGSLGY AIVDADNAKQ VVMLTEELLP YPHNPASIEQ DQVDLIVKVD RVGDAAKIGA       240
     GATRMTTNPR ELLIARSAAD VIVNSGYFKE GFSMQTGTGG ASLAVTRFLE DKMRSRDIRA       300
     DFALGGITAT MVDLHEKGLI RKLLDVQSFD SHAAQSLARN PNHIEISANQ YANWGSKGAS       360
     VDRLDVVVLS ALEIDTQFNV NVLTGSDGVL RGASGGHCDT AIASALSIIV APLVRGRIPT       420
     LVDNVLTCIT PGSSVDILVT DHGIAVNPAR PELAERLQEA GIKVVSIEWL RERARLLTGE       480
     PQPIEFTDRV VAVVRYRDGS VIDVVHQVKE                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page