(data stored in ACNUC7421 zone)

EMBL: CP000948.CLPP

CP000948.CLPP        Location/Qualifiers
FT   CDS             395232..395855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="ECDH10B_0393"
FT                   /product="proteolytic subunit of ClpA-ClpP and ClpX-ClpP
FT                   ATP-dependent serine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01565"
FT                   /protein_id="ACB01565.1"
FT                   /translation="MSYSGERDNFAPHMALVPMVIEQTSRGERSFDIYSRLLKERVIFL
FT                   TGQVEDHMANLIVAQMLFLEAENPEKDIYLYINSPGGVITAGMSIYDTMQFIKPDVSTI
FT                   CMGQAASMGAFLLTAGAKGKRFCLPNSRVMIHQPLGGYQGQATDIEIHAREILKVKGRM
FT                   NELMALHTGQSLEQIERDTERDRFLSAPEAVEYGLVDSILTHRN"
     MSYSGERDNF APHMALVPMV IEQTSRGERS FDIYSRLLKE RVIFLTGQVE DHMANLIVAQ        60
     MLFLEAENPE KDIYLYINSP GGVITAGMSI YDTMQFIKPD VSTICMGQAA SMGAFLLTAG       120
     AKGKRFCLPN SRVMIHQPLG GYQGQATDIE IHAREILKVK GRMNELMALH TGQSLEQIER       180
     DTERDRFLSA PEAVEYGLVD SILTHRN                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page