(data stored in ACNUC7421 zone)

EMBL: CP000948.CUSS

CP000948.CUSS        Location/Qualifiers
FT   CDS             complement(531883..533325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusS"
FT                   /locus_tag="ECDH10B_0528"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system with CusR, senses copper ions"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01691"
FT                   /protein_id="ACB01691.1"
FT                   /translation="MVSKPFQRPFSLATRLTFFISLATIAAFFAFAWIMIHSVKVHFAE
FT                   QDINDLKEISATLERVLNHPDETQARRLMTLEDIVSGYSNVLISLADSQGKTVYHSPGA
FT                   PDIREFTRDAIPDKDAQGGEVYLLSGPTMMMPGHGHGHMEHSNWRMINLPVGPLVDGKP
FT                   IYTLYIALSIDFHLHYINDLMNKLIMTASVISILIVFIVLLAVHKGHAPIRSVSRQIQN
FT                   ITSKDLDVRLDPQTVPIELEQLVLSFNHMIERIEDVFTRQSNFSADIAHEIRTPITNLI
FT                   TQTEIALSQSRSQKELEDVLYSNLEELTRMAKMVSDMLFLAQADNNQLIPEKKMLNLAD
FT                   EVGKVFDFFEALAEDRGVELRFVGDKCQVAGDPLMLRRALSNLLSNALRYTPTGETIVV
FT                   RCQTVDHLVQVIVENPGTPIAPEHLPRLFDRFYRVDPSRQRKGEGSGIGLAIVKSIVVA
FT                   HKGTVAVTSDARGTRFVITLPA"
     MVSKPFQRPF SLATRLTFFI SLATIAAFFA FAWIMIHSVK VHFAEQDIND LKEISATLER        60
     VLNHPDETQA RRLMTLEDIV SGYSNVLISL ADSQGKTVYH SPGAPDIREF TRDAIPDKDA       120
     QGGEVYLLSG PTMMMPGHGH GHMEHSNWRM INLPVGPLVD GKPIYTLYIA LSIDFHLHYI       180
     NDLMNKLIMT ASVISILIVF IVLLAVHKGH APIRSVSRQI QNITSKDLDV RLDPQTVPIE       240
     LEQLVLSFNH MIERIEDVFT RQSNFSADIA HEIRTPITNL ITQTEIALSQ SRSQKELEDV       300
     LYSNLEELTR MAKMVSDMLF LAQADNNQLI PEKKMLNLAD EVGKVFDFFE ALAEDRGVEL       360
     RFVGDKCQVA GDPLMLRRAL SNLLSNALRY TPTGETIVVR CQTVDHLVQV IVENPGTPIA       420
     PEHLPRLFDR FYRVDPSRQR KGEGSGIGLA IVKSIVVAHK GTVAVTSDAR GTRFVITLPA       480
//

If you have problems or comments...

PBIL Back to PBIL home page