(data stored in ACNUC7421 zone)

EMBL: CP000948.CYOC

CP000948.CYOC        Location/Qualifiers
FT   CDS             complement(386601..387215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="ECDH10B_0386"
FT                   /product="cytochrome o ubiquinol oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01558"
FT                   /protein_id="ACB01558.1"
FT                   /translation="MATDTLTHATAHAHEHGHHDAGGTKIFGFWIYLMSDCILFSILFA
FT                   TYAVLVNGTAGGPTGKDIFELPFVLVETFLLLFSSITYGMAAIAMYKNNKSQVISWLAL
FT                   TWLFGAGFIGMEIYEFHHLIVNGMGPDRSGFLSAFFALVGTHGLHVTSGLIWMAVLMVQ
FT                   IARRGLTSTNRTRIMCLSLFWHFLDVVWICVFTVVYLMGAM"
     MATDTLTHAT AHAHEHGHHD AGGTKIFGFW IYLMSDCILF SILFATYAVL VNGTAGGPTG        60
     KDIFELPFVL VETFLLLFSS ITYGMAAIAM YKNNKSQVIS WLALTWLFGA GFIGMEIYEF       120
     HHLIVNGMGP DRSGFLSAFF ALVGTHGLHV TSGLIWMAVL MVQIARRGLT STNRTRIMCL       180
     SLFWHFLDVV WICVFTVVYL MGAM                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page