(data stored in ACNUC7421 zone)

EMBL: CP000948.CYOD

CP000948.CYOD        Location/Qualifiers
FT   CDS             complement(386272..386601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="ECDH10B_0385"
FT                   /product="cytochrome o ubiquinol oxidase subunit IV"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01557"
FT                   /protein_id="ACB01557.1"
FT                   /translation="MSHSTDHSGASHGSVKTYMTGFILSIILTVIPFWMVMTGAASPAV
FT                   ILGTILAMAVVQVLVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNY
FT                   NMMMH"
     MSHSTDHSGA SHGSVKTYMT GFILSIILTV IPFWMVMTGA ASPAVILGTI LAMAVVQVLV        60
     HLVCFLHMNT KSDEGWNMTA FVFTVLIIAI LVVGSIWIMW NLNYNMMMH                   109
//

If you have problems or comments...

PBIL Back to PBIL home page