(data stored in ACNUC7421 zone)

EMBL: CP000948.DJLA

CP000948.DJLA        Location/Qualifiers
FT   CDS             57364..58179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="ECDH10B_0056"
FT                   /product="DnaJ-like protein, membrane anchored"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01260"
FT                   /protein_id="ACB01260.1"
FT                   /translation="MQYWGKIIGVAVALLMGGGFWGVVLGLLIGHMFDKARSRKMAWFA
FT                   NQRERQALFFATTFEVMGHLTKSKGRVTEADIHIASQLMDRMNLHGASRTAAQNAFRVG
FT                   KSDNYPLREKMRQFRSVCFGRFDLIRMFLEIQIQAAFADGSLHPNERAVLYVIAEELGI
FT                   SRAQFDQFLRMMQGGAQFGGGYQQQTGGGNWQQAQRGPTLEDACNVLGVKPTDDATTIK
FT                   RAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEIQQAYELIKQQKGFK"
     MQYWGKIIGV AVALLMGGGF WGVVLGLLIG HMFDKARSRK MAWFANQRER QALFFATTFE        60
     VMGHLTKSKG RVTEADIHIA SQLMDRMNLH GASRTAAQNA FRVGKSDNYP LREKMRQFRS       120
     VCFGRFDLIR MFLEIQIQAA FADGSLHPNE RAVLYVIAEE LGISRAQFDQ FLRMMQGGAQ       180
     FGGGYQQQTG GGNWQQAQRG PTLEDACNVL GVKPTDDATT IKRAYRKLMS EHHPDKLVAK       240
     GLPPEMMEMA KQKAQEIQQA YELIKQQKGF K                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page