(data stored in ACNUC7421 zone)

EMBL: CP000948.DNAQ

CP000948.DNAQ        Location/Qualifiers
FT   CDS             210171..210902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="ECDH10B_0196"
FT                   /product="DNA polymerase III epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01388"
FT                   /protein_id="ACB01388.1"
FT                   /translation="MSTAITRQIVLDTETTGMNQIGAHYEGHKIIEIGAVEVVNRRLTG
FT                   NNFHVYLKPDRLVDPEAFGVHGIADEFLLDKPTFAEVADEFMDYIRGAELVIHNAAFDI
FT                   GFMDYEFSLLKRDIPKTNTFCKVTDSLAVARKMFPGKRNSLDALCARYEIDNSKRTLHG
FT                   ALLDAQILAEVYLAMTGGQTSMAFAMEGETQQQQGEATIQRIVRQASKLRVVFATDEEI
FT                   AAHEARLDLVQKKGGSCLWRA"
     MSTAITRQIV LDTETTGMNQ IGAHYEGHKI IEIGAVEVVN RRLTGNNFHV YLKPDRLVDP        60
     EAFGVHGIAD EFLLDKPTFA EVADEFMDYI RGAELVIHNA AFDIGFMDYE FSLLKRDIPK       120
     TNTFCKVTDS LAVARKMFPG KRNSLDALCA RYEIDNSKRT LHGALLDAQI LAEVYLAMTG       180
     GQTSMAFAME GETQQQQGEA TIQRIVRQAS KLRVVFATDE EIAAHEARLD LVQKKGGSCL       240
     WRA                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page