(data stored in ACNUC7421 zone)

EMBL: CP000948.EAEH

CP000948.EAEH        Location/Qualifiers
FT   CDS             289131..290018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eaeH"
FT                   /locus_tag="ECDH10B_0286"
FT                   /product="attaching and effacing protein, pathogenesis
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01464"
FT                   /protein_id="ACB01464.1"
FT                   /translation="MSHYKTGHKQPRFRYSVLARCVAWANISVQVLFPLAVTFTPVMAA
FT                   RAQHAVQPRLSMGNTTVTADNNVEKNVASFAANAGTFLSSQPDSDATRNFITGMATAKA
FT                   NQEIQEWLGKYGTARVKLNVDKDFSLKDSSLEMLYPIYDTPTNMLFTQGAIHRTDDRTQ
FT                   SNIGFGWRHFSGNDWMAGVNTFIDHDLSRSHTRIGVGAEYWRDYLKLSANGYIRASGWK
FT                   KSPDIEDYQERPANGWDIRAEGYLPAWPQLGASLMYEQYYGDEVGLFGKDKRQKDPHAI
FT                   SAEVTYTPVPLTQQ"
     MSHYKTGHKQ PRFRYSVLAR CVAWANISVQ VLFPLAVTFT PVMAARAQHA VQPRLSMGNT        60
     TVTADNNVEK NVASFAANAG TFLSSQPDSD ATRNFITGMA TAKANQEIQE WLGKYGTARV       120
     KLNVDKDFSL KDSSLEMLYP IYDTPTNMLF TQGAIHRTDD RTQSNIGFGW RHFSGNDWMA       180
     GVNTFIDHDL SRSHTRIGVG AEYWRDYLKL SANGYIRASG WKKSPDIEDY QERPANGWDI       240
     RAEGYLPAWP QLGASLMYEQ YYGDEVGLFG KDKRQKDPHA ISAEVTYTPV PLTQQ            295
//

If you have problems or comments...

PBIL Back to PBIL home page