(data stored in ACNUC7421 zone)

EMBL: CP000948.EMRE

CP000948.EMRE        Location/Qualifiers
FT   CDS             506870..507202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrE"
FT                   /locus_tag="ECDH10B_0499"
FT                   /product="DLP12 prophage; multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01666"
FT                   /protein_id="ACB01666.1"
FT                   /translation="MNPYIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFW
FT                   LLAQTLAYIPTGIAYAIWSGVGIVLISLLSWGFFGQRLDLPAIIGMMLICAGVLIINLL
FT                   SRSTPH"
     MNPYIYLGGA ILAEVIGTTL MKFSEGFTRL WPSVGTIICY CASFWLLAQT LAYIPTGIAY        60
     AIWSGVGIVL ISLLSWGFFG QRLDLPAIIG MMLICAGVLI INLLSRSTPH                  110
//

If you have problems or comments...

PBIL Back to PBIL home page