(data stored in ACNUC7421 zone)

EMBL: CP000948.FIXA

CP000948.FIXA        Location/Qualifiers
FT   CDS             42403..43173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixA"
FT                   /locus_tag="ECDH10B_0042"
FT                   /product="predicted electron transfer flavoprotein subunit,
FT                   ETFP adenine nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01246"
FT                   /db_xref="GOA:B1XBG6"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR023463"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XBG6"
FT                   /protein_id="ACB01246.1"
FT                   /translation="MKIITCYKCVPDEQDIAVNNADGSLDFSKADAKISQYDLNAIEAA
FT                   CQLKQQAAEAQVTALSVGGKALTNAKGRKDVLSRGPDELIVVIDDQFEQALPQQTASAL
FT                   AAAAQKAGFDLILCGDGSSDLYAQQVGLLVGEILNIPAVNGVSKIISLTADTLTVEREL
FT                   EDETETLSIPLPAVVAVSTDINSPQIPSMKAILGAAKKPVQVWSAADIGFNAEAAWSEQ
FT                   QVAAPKQRERQRIVIEGDGEEQIAAFAENLRKVI"
     MKIITCYKCV PDEQDIAVNN ADGSLDFSKA DAKISQYDLN AIEAACQLKQ QAAEAQVTAL        60
     SVGGKALTNA KGRKDVLSRG PDELIVVIDD QFEQALPQQT ASALAAAAQK AGFDLILCGD       120
     GSSDLYAQQV GLLVGEILNI PAVNGVSKII SLTADTLTVE RELEDETETL SIPLPAVVAV       180
     STDINSPQIP SMKAILGAAK KPVQVWSAAD IGFNAEAAWS EQQVAAPKQR ERQRIVIEGD       240
     GEEQIAAFAE NLRKVI                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page