(data stored in ACNUC7421 zone)

EMBL: CP000948.FIXC

CP000948.FIXC        Location/Qualifiers
FT   CDS             44180..45466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixC"
FT                   /locus_tag="ECDH10B_0044"
FT                   /product="predicted oxidoreductase with FAD/NAD(P)-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01248"
FT                   /protein_id="ACB01248.1"
FT                   /translation="MSEDIFDAIIVGAGLAGSVAALVLAREGAQVLVIERGNSAGAKNV
FT                   TGGRLYAHSLEHIIPGFADSAPVERLITHEKLAFMTEKSAMTMDYCNGDETSPSQRSYS
FT                   VLRSKFDAWLMEQAEEAGAQLITGIRVDNLVQRDGKVVGVEADGDVIEAKTVILADGVN
FT                   SILAEKLGMAKRVKPTDVAVGVKELIELPKSVIEDRFQLQGNQGAACLFAGSPTDGLMG
FT                   GGFLYTNENTLSLGLVCGLHHLHDAKKSVPQMLEDFKQHPAVAPLIAGGKLVEYSAHVV
FT                   PEAGINMLPELVGDGVLIAGDAAGMCMNLGFTIRGMDLAIAAGEAAAKTVLSAMKSDDF
FT                   SKQKLAEYRQHLESGPLRDMRMYQKLPAFLDNPRMFSGYPELAVGVARDLFTIDGSAPE
FT                   LMRKKILRHGKKVGFINLIKDGMKGVTVL"
     MSEDIFDAII VGAGLAGSVA ALVLAREGAQ VLVIERGNSA GAKNVTGGRL YAHSLEHIIP        60
     GFADSAPVER LITHEKLAFM TEKSAMTMDY CNGDETSPSQ RSYSVLRSKF DAWLMEQAEE       120
     AGAQLITGIR VDNLVQRDGK VVGVEADGDV IEAKTVILAD GVNSILAEKL GMAKRVKPTD       180
     VAVGVKELIE LPKSVIEDRF QLQGNQGAAC LFAGSPTDGL MGGGFLYTNE NTLSLGLVCG       240
     LHHLHDAKKS VPQMLEDFKQ HPAVAPLIAG GKLVEYSAHV VPEAGINMLP ELVGDGVLIA       300
     GDAAGMCMNL GFTIRGMDLA IAAGEAAAKT VLSAMKSDDF SKQKLAEYRQ HLESGPLRDM       360
     RMYQKLPAFL DNPRMFSGYP ELAVGVARDL FTIDGSAPEL MRKKILRHGK KVGFINLIKD       420
     GMKGVTVL                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page