(data stored in ACNUC7421 zone)

EMBL: CP000948.FIXX

CP000948.FIXX        Location/Qualifiers
FT   CDS             45463..45750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixX"
FT                   /locus_tag="ECDH10B_0045"
FT                   /product="predicted 4Fe-4S ferredoxin-type protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01249"
FT                   /protein_id="ACB01249.1"
FT                   /translation="MTSPVNVDVKLGVNKFNVDEEHPHIVVKADADKQALELLVKACPA
FT                   GLYKKQDDGSVRFDYAGCLECGTCRILGLGSALEQWEYPRGTFGVEFRYG"
     MTSPVNVDVK LGVNKFNVDE EHPHIVVKAD ADKQALELLV KACPAGLYKK QDDGSVRFDY        60
     AGCLECGTCR ILGLGSALEQ WEYPRGTFGV EFRYG                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page