(data stored in ACNUC7421 zone)

EMBL: CP000948.FTSL

CP000948.FTSL        Location/Qualifiers
FT   CDS             65136..65501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="ECDH10B_0065"
FT                   /product="membrane bound cell division protein at septum
FT                   containing leucine zipper motif"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01264"
FT                   /protein_id="ACB01264.1"
FT                   /translation="MISRVTEALSKVKGSMGSHERHALPGVIGDDLLRFGKLPLCLFIC
FT                   IILTAVTVVTTAHHTRLLTAQREQLVLERDALDIEWRNLILEENALGDHSRVERIATEK
FT                   LQMQHVDPSQENIVVQK"
     MISRVTEALS KVKGSMGSHE RHALPGVIGD DLLRFGKLPL CLFICIILTA VTVVTTAHHT        60
     RLLTAQREQL VLERDALDIE WRNLILEENA LGDHSRVERI ATEKLQMQHV DPSQENIVVQ       120
     K                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page