(data stored in ACNUC7421 zone)

EMBL: CP000948.FTSQ

CP000948.FTSQ        Location/Qualifiers
FT   CDS             77259..78089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="ECDH10B_0075"
FT                   /product="membrane anchored protein involved in growth of
FT                   wall at septum"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01274"
FT                   /protein_id="ACB01274.1"
FT                   /translation="MSQAALNTRNSEEEVSSRRNNGTRLAGILFLLTVLTTVLVSGWVV
FT                   LGWMEDAQRLPLSKLVLTGERHYTRNDDIRQSILALGEPGTFMTQDVNIIQTQIEQRLP
FT                   WIKQVSVRKQWPDELKIHLVEYVPIARWNDQHMVDAEGNTFSVPPERTSKQVLPMLYGP
FT                   EGSANEVLQGYREMGQMLAKDRFTLKEAAMTARRSWQLTLNNDIKLNLGRGDTMKRLAR
FT                   FVELYPVLQQQAQTDGKRISYVDLRYDSGAAVGWAPLPPEESTQQQNQAQAEQQ"
     MSQAALNTRN SEEEVSSRRN NGTRLAGILF LLTVLTTVLV SGWVVLGWME DAQRLPLSKL        60
     VLTGERHYTR NDDIRQSILA LGEPGTFMTQ DVNIIQTQIE QRLPWIKQVS VRKQWPDELK       120
     IHLVEYVPIA RWNDQHMVDA EGNTFSVPPE RTSKQVLPML YGPEGSANEV LQGYREMGQM       180
     LAKDRFTLKE AAMTARRSWQ LTLNNDIKLN LGRGDTMKRL ARFVELYPVL QQQAQTDGKR       240
     ISYVDLRYDS GAAVGWAPLP PEESTQQQNQ AQAEQQ                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page