(data stored in ACNUC7421 zone)

EMBL: CP000948.GLTK

CP000948.GLTK        Location/Qualifiers
FT   CDS             complement(623810..624484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltK"
FT                   /locus_tag="ECDH10B_0614"
FT                   /product="glutamate and aspartate transporter subunit,
FT                   membrane component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01774"
FT                   /protein_id="ACB01774.1"
FT                   /translation="MYEFDWSSIVPSLPYLLDGLVITLKITVTAVVIGILWGTMLAVMR
FT                   LSSFAPVAWFAKAYVNVFRSIPLVMVLLWFYLIVPGFLQNVLGLSPKNDIRLISAMVAF
FT                   SMFEAAYYSEIIRAGIQSISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGI
FT                   VLFQDTSLVYVLSLADFFRTASTIGERDGTQVEMILFAGFVYFVISLSASLLVSYLKRR
FT                   TA"
     MYEFDWSSIV PSLPYLLDGL VITLKITVTA VVIGILWGTM LAVMRLSSFA PVAWFAKAYV        60
     NVFRSIPLVM VLLWFYLIVP GFLQNVLGLS PKNDIRLISA MVAFSMFEAA YYSEIIRAGI       120
     QSISRGQSSA ALALGMTHWQ SMKLIILPQA FRAMVPLLLT QGIVLFQDTS LVYVLSLADF       180
     FRTASTIGER DGTQVEMILF AGFVYFVISL SASLLVSYLK RRTA                        224
//

If you have problems or comments...

PBIL Back to PBIL home page