(data stored in ACNUC7421 zone)

EMBL: CP000948.GLXK

CP000948.GLXK        Location/Qualifiers
FT   CDS             480443..481588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="ECDH10B_0470"
FT                   /product="glycerate kinase II"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01639"
FT                   /protein_id="ACB01639.1"
FT                   /translation="MKIVIAPDSFKESLSAEKCCQAIKAGFSTLFPDANYICLPIADGG
FT                   EGTVDAMVAATGGNIVTLEVCGPMGEKVNAFYGLTGDGKTAVIEMAAASGLMLVAPEKR
FT                   NPLLASSFGTGELIRHALDNDIRHIILGIGGSATVDGGMGMAQALGVRFLDADGQALAA
FT                   NGGNLARVASIEMDECDPRLANCHIEVACDVDNPLVGARGAAAVFGPQKGATPEMVEEL
FT                   EQGLQNYARVLQQQTEINVCQMAGGGAAGGMGIAAAVFLNADIKPGIEIVLNAVNLAQA
FT                   VQGAALVITGEGRIDSQTAGGKAPLGVASVAKQFNVPVIGIAGVLGDGVEVVHQYGIDA
FT                   VFSILPRLAPLAEVLASGETNLFNSARNIACAIKIGQGIKN"
     MKIVIAPDSF KESLSAEKCC QAIKAGFSTL FPDANYICLP IADGGEGTVD AMVAATGGNI        60
     VTLEVCGPMG EKVNAFYGLT GDGKTAVIEM AAASGLMLVA PEKRNPLLAS SFGTGELIRH       120
     ALDNDIRHII LGIGGSATVD GGMGMAQALG VRFLDADGQA LAANGGNLAR VASIEMDECD       180
     PRLANCHIEV ACDVDNPLVG ARGAAAVFGP QKGATPEMVE ELEQGLQNYA RVLQQQTEIN       240
     VCQMAGGGAA GGMGIAAAVF LNADIKPGIE IVLNAVNLAQ AVQGAALVIT GEGRIDSQTA       300
     GGKAPLGVAS VAKQFNVPVI GIAGVLGDGV EVVHQYGIDA VFSILPRLAP LAEVLASGET       360
     NLFNSARNIA CAIKIGQGIK N                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page