(data stored in ACNUC7421 zone)

EMBL: CP000948.HHA

CP000948.HHA         Location/Qualifiers
FT   CDS             complement(418645..418863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hha"
FT                   /locus_tag="ECDH10B_0416"
FT                   /product="haemolysin expression modulating protein"
FT                   /note="contains the nonsynonymous change P5F"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01587"
FT                   /protein_id="ACB01587.1"
FT                   /translation="MSEKFLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYS
FT                   AADHRLAELTMNKLYDKIPSSVWKFIR"
     MSEKFLTKTD YLMRLRRCQT IDTLERVIEK NKYELSDNEL AVFYSAADHR LAELTMNKLY        60
     DKIPSSVWKF IR                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page