(data stored in ACNUC7421 zone)

EMBL: CP000948.HOFC

CP000948.HOFC        Location/Qualifiers
FT   CDS             complement(88626..89828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hofC"
FT                   /locus_tag="ECDH10B_0086"
FT                   /product="assembly protein in type IV pilin biogenesis,
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01285"
FT                   /protein_id="ACB01285.1"
FT                   /translation="MASKQLWRWHGITGDGNAQDGMLWAESRTLLLMALQQQMVTPLSL
FT                   KRIAINSAQWRGDKSAEVIHQLATLLKAGLTLSEGLALLAEQHPSKQWQALLQSLAHDL
FT                   EQGIAFSNALLPWSEVFPPLYQAMIRTGELTGKLDECCFELARQQKAQRQLTDKVKSAL
FT                   RYPIIILAMAIMVVVAMLHFVLPEFAAIYKTFNTPLPALTQGIMTLADFSGEWSWLLVL
FT                   FGFLLAIANKLLMRRPTWLIVRQKLLLRIPIMGSLMRGQKLTQIFTILALTQSAGITFL
FT                   QGVESVRETMRCPYWVQLLTQIQHDISNGQPIWLALKNTGEFSPLCLQLVRTGEASGSL
FT                   DLMLDNLAHHHRENTMALADNLAALLEPALLIITGGIIGTLVVAMYLPIFHLGDAMSGM
FT                   G"
     MASKQLWRWH GITGDGNAQD GMLWAESRTL LLMALQQQMV TPLSLKRIAI NSAQWRGDKS        60
     AEVIHQLATL LKAGLTLSEG LALLAEQHPS KQWQALLQSL AHDLEQGIAF SNALLPWSEV       120
     FPPLYQAMIR TGELTGKLDE CCFELARQQK AQRQLTDKVK SALRYPIIIL AMAIMVVVAM       180
     LHFVLPEFAA IYKTFNTPLP ALTQGIMTLA DFSGEWSWLL VLFGFLLAIA NKLLMRRPTW       240
     LIVRQKLLLR IPIMGSLMRG QKLTQIFTIL ALTQSAGITF LQGVESVRET MRCPYWVQLL       300
     TQIQHDISNG QPIWLALKNT GEFSPLCLQL VRTGEASGSL DLMLDNLAHH HRENTMALAD       360
     NLAALLEPAL LIITGGIIGT LVVAMYLPIF HLGDAMSGMG                             400
//

If you have problems or comments...

PBIL Back to PBIL home page