(data stored in ACNUC7421 zone)

EMBL: CP000948.HOKC

CP000948.HOKC        Location/Qualifiers
FT   CDS             complement(16751..16903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hokC"
FT                   /locus_tag="ECDH10B_0018"
FT                   /product="toxic membrane protein, small"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01223"
FT                   /protein_id="ACB01223.1"
FT                   /translation="MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFT
FT                   AYESE"
     MKQHKAMIVA LIVICITAVV AALVTRKDLC EVHIRTGQTE VAVFTAYESE                   50
//

If you have problems or comments...

PBIL Back to PBIL home page