(data stored in ACNUC7421 zone)

EMBL: CP000948.HTRE

CP000948.HTRE        Location/Qualifiers
FT   CDS             complement(126933..129530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htrE"
FT                   /locus_tag="ECDH10B_0119"
FT                   /product="predicted outer membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01318"
FT                   /protein_id="ACB01318.1"
FT                   /translation="MTIEYTKNYHHLTRIATFCALLYCNTAFSAELVEYDHTFLMGQNA
FT                   SNIDLSRYSEGNPAIPGVYDVSVYVNDQPIINQSITFVAIEGKKNAQACITLKNLLQFH
FT                   INSPDINNEKAVLLARDETLGNCLNLTEIIPQASVRYDVNDQRLDIDVPQAWVMKNYQN
FT                   YVDPSLWENGINAAMLSYNLNGYHSETPGRKNESIYAAFNGGMNLGAWRLRASGNYNWM
FT                   TDSGSNYDFKNRYVQRDIASLRSQLILGESYTTGETFDSVSIRGIRLYSDSRMLPPTLA
FT                   SFAPIIHGVANTNAKVTITQGGYKIYETTVPPGAFVIDDLSPSGYGSDLIVTIEESDGS
FT                   KRTFSQPFSSVVQMLRPGVGRWDISGGQVLKDDIQDEPNLFQASYYYGLNNYLTGYTGI
FT                   QITDNNYTAGLLGLGLNTSVGAFSFDVTHSNVRIPDDKTYQGQSYRVSWNKLFEETSTS
FT                   LNIAAYRYSTQNYLGLNDALTLIDEVKHPEQDLEPKSMRNYSRMKNQVTVSINQPLKFE
FT                   KKDYGSFYLSGSWSDYWASGQNRSNYSIGYSNSTSWGSYSVSAQRSWNEDGDTDDSVYL
FT                   SFTIPIEKLLGTEQRTSGFQSIDTQISSDFKGNNQLNVSSSGYSDNARVSYSVNTGYTM
FT                   NKASKDLSYVGGYASYESPWGTLAGSISANSDNSRQVSLSTDGGFVLHSGGLTFSNDSF
FT                   SDSDTLAVVQAPGAQGARINYGNSTIDRWGYGVTSALSPYHENRIALDINDLENDVELK
FT                   STSAVAVPRQGSVVFADFETVQGQSAIMNITRSDGKNIPFAADIYDEQGNVIGNVGQGG
FT                   QAFVRGIEQQGNISIKWLEQSKPVSCLAHYQQSPEAEKIAQSIILNGIRCQIQ"
     MTIEYTKNYH HLTRIATFCA LLYCNTAFSA ELVEYDHTFL MGQNASNIDL SRYSEGNPAI        60
     PGVYDVSVYV NDQPIINQSI TFVAIEGKKN AQACITLKNL LQFHINSPDI NNEKAVLLAR       120
     DETLGNCLNL TEIIPQASVR YDVNDQRLDI DVPQAWVMKN YQNYVDPSLW ENGINAAMLS       180
     YNLNGYHSET PGRKNESIYA AFNGGMNLGA WRLRASGNYN WMTDSGSNYD FKNRYVQRDI       240
     ASLRSQLILG ESYTTGETFD SVSIRGIRLY SDSRMLPPTL ASFAPIIHGV ANTNAKVTIT       300
     QGGYKIYETT VPPGAFVIDD LSPSGYGSDL IVTIEESDGS KRTFSQPFSS VVQMLRPGVG       360
     RWDISGGQVL KDDIQDEPNL FQASYYYGLN NYLTGYTGIQ ITDNNYTAGL LGLGLNTSVG       420
     AFSFDVTHSN VRIPDDKTYQ GQSYRVSWNK LFEETSTSLN IAAYRYSTQN YLGLNDALTL       480
     IDEVKHPEQD LEPKSMRNYS RMKNQVTVSI NQPLKFEKKD YGSFYLSGSW SDYWASGQNR       540
     SNYSIGYSNS TSWGSYSVSA QRSWNEDGDT DDSVYLSFTI PIEKLLGTEQ RTSGFQSIDT       600
     QISSDFKGNN QLNVSSSGYS DNARVSYSVN TGYTMNKASK DLSYVGGYAS YESPWGTLAG       660
     SISANSDNSR QVSLSTDGGF VLHSGGLTFS NDSFSDSDTL AVVQAPGAQG ARINYGNSTI       720
     DRWGYGVTSA LSPYHENRIA LDINDLENDV ELKSTSAVAV PRQGSVVFAD FETVQGQSAI       780
     MNITRSDGKN IPFAADIYDE QGNVIGNVGQ GGQAFVRGIE QQGNISIKWL EQSKPVSCLA       840
     HYQQSPEAEK IAQSIILNGI RCQIQ                                             865
//

If you have problems or comments...

PBIL Back to PBIL home page