(data stored in ACNUC7421 zone)

EMBL: CP000948.HUPB

CP000948.HUPB        Location/Qualifiers
FT   CDS             400006..400278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="ECDH10B_0396"
FT                   /product="HU, DNA-binding transcriptional regulator, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01568"
FT                   /protein_id="ACB01568.1"
FT                   /translation="MNKSQLIDKIAAGADISKAAAGRALDAIIASVTESLKEGDDVALV
FT                   GFGTFAVKERAARTGRNPQTGKEITIAAAKVPSFRAGKALKDAVN"
     MNKSQLIDKI AAGADISKAA AGRALDAIIA SVTESLKEGD DVALVGFGTF AVKERAARTG        60
     RNPQTGKEIT IAAAKVPSFR AGKALKDAVN                                         90
//

If you have problems or comments...

PBIL Back to PBIL home page