(data stored in ACNUC7421 zone)

EMBL: CP000948.INSA-1

CP000948.INSA-1      Location/Qualifiers
FT   CDS             complement(20233..20508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insA-1"
FT                   /locus_tag="ECDH10B_0023"
FT                   /product="IS1 repressor protein InsA"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01227"
FT                   /protein_id="ACB01227.1"
FT                   /translation="MASVSISCPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQLQFTY
FT                   TASQPGTHQKIIDMAMNGVGCRATARIMGVGLNTILRHLKNSGRSR"
     MASVSISCPS CSATDGVVRN GKSTAGHQRY LCSHCRKTWQ LQFTYTASQP GTHQKIIDMA        60
     MNGVGCRATA RIMGVGLNTI LRHLKNSGRS R                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page