(data stored in ACNUC7421 zone)

EMBL: CP000948.INSE-3

CP000948.INSE-3      Location/Qualifiers
FT   CDS             505388..505696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insE-3"
FT                   /locus_tag="ECDH10B_0496"
FT                   /product="DLP12 prophage; IS3 element protein InsE"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01663"
FT                   /protein_id="ACB01663.1"
FT                   /translation="MTHMTKTVSTSKKPRKQHSPEFRSEALKLAERIGVTAAARELSLY
FT                   ESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLAERDEELAILQKAATYFAKRLK"
     MTHMTKTVST SKKPRKQHSP EFRSEALKLA ERIGVTAAAR ELSLYESQLY NWRSKQQNQQ        60
     TSSERELEMS TEIARLKRQL AERDEELAIL QKAATYFAKR LK                          102
//

If you have problems or comments...

PBIL Back to PBIL home page