(data stored in ACNUC7421 zone)

EMBL: CP000948.INSF-1

CP000948.INSF-1      Location/Qualifiers
FT   CDS             290361..291227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insF-1"
FT                   /locus_tag="ECDH10B_0288"
FT                   /product="IS3 element protein InsF"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01466"
FT                   /protein_id="ACB01466.1"
FT                   /translation="MKYVFIEKHQAEFSIKAMCRVLRVARSGWYTWCQRRTRISTRQQF
FT                   RQHCDSVVLAAFTRSKQRYGAPRLTDELRAQGYPFNVKTVAASLRRQGLRAKASRKFSP
FT                   VSYRAHGLPVSENLLEQDFYASGPNQKWAGDITYLRTDEGWLYLAVVIDLWSRAVIGWS
FT                   MSPRMTAQLACDALQMALWRRKRPRNVIVHTDRGGQYCSADYQAQLKRHNLRGSMSAKG
FT                   CCYDNACVESFFHSLKVECIHGEHFISREIMRATVFNYIECDYNRWRRHSWCGGLSPEQ
FT                   FENKNLA"
     MKYVFIEKHQ AEFSIKAMCR VLRVARSGWY TWCQRRTRIS TRQQFRQHCD SVVLAAFTRS        60
     KQRYGAPRLT DELRAQGYPF NVKTVAASLR RQGLRAKASR KFSPVSYRAH GLPVSENLLE       120
     QDFYASGPNQ KWAGDITYLR TDEGWLYLAV VIDLWSRAVI GWSMSPRMTA QLACDALQMA       180
     LWRRKRPRNV IVHTDRGGQY CSADYQAQLK RHNLRGSMSA KGCCYDNACV ESFFHSLKVE       240
     CIHGEHFISR EIMRATVFNY IECDYNRWRR HSWCGGLSPE QFENKNLA                    288
//

If you have problems or comments...

PBIL Back to PBIL home page