(data stored in ACNUC7421 zone)

EMBL: CP000948.KDPC

CP000948.KDPC        Location/Qualifiers
FT   CDS             complement(776222..776794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="ECDH10B_0762"
FT                   /product="potassium translocating ATPase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01905"
FT                   /db_xref="GOA:B1X6M7"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1X6M7"
FT                   /protein_id="ACB01905.1"
FT                   /translation="MSGLRPALSTFIFLLLITGGVYPLLTTVLGQWWFPWQANGSLIRE
FT                   GDTVRGSALIGQNFTGNGYFHGRPSATAEMPYNPQASGGSNLAVSNPELDKLIAARVAA
FT                   LRAANPDASASVPVELVTASASGLDNNITPQAAAWQIPRVAKARNLSVEQLTQLIAKYS
FT                   QQPLVKYIGQPVVNIVELNLALDKLDE"
     MSGLRPALST FIFLLLITGG VYPLLTTVLG QWWFPWQANG SLIREGDTVR GSALIGQNFT        60
     GNGYFHGRPS ATAEMPYNPQ ASGGSNLAVS NPELDKLIAA RVAALRAANP DASASVPVEL       120
     VTASASGLDN NITPQAAAWQ IPRVAKARNL SVEQLTQLIA KYSQQPLVKY IGQPVVNIVE       180
     LNLALDKLDE                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page