(data stored in ACNUC7421 zone)

EMBL: CP000948.KDPD

CP000948.KDPD        Location/Qualifiers
FT   CDS             complement(773545..776229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpD"
FT                   /locus_tag="ECDH10B_0761"
FT                   /product="fused sensory histidine kinase in two-component
FT                   regulatory system with KdpE: signal sensing protein and
FT                   sensory histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01904"
FT                   /protein_id="ACB01904.1"
FT                   /translation="MNNEPLRPDPDRLLEQTAAPHRGKLKVFFGACAGVGKTWAMLAEA
FT                   QRLRAQGLDIVVGVVETHGRKDTAAMLEGLAVLPLKRQAYRGRHISEFDLDAALARRPA
FT                   LILMDELAHSNAPGSRHPKRWQDIEELLEAGIDVFTTVNVQHLESLNDVVSGVTGIQVR
FT                   ETVPDPFFDAADDVVLVDLPPDDLRQRLKEGKVYIAGQAERAIEHFFRKGNLIALRELA
FT                   LRRTADRVDEQMRAWRGHPGEEKVWHTRDAILLCIGHNTGSEKLVRAAARLASRLGSVW
FT                   HAVYVETPALHRLPEKKRRAILSALRLAQELGAETATLSDPAEEKAVVRYAREHNLGKI
FT                   ILGRPASRRWWRRETFADRLARIAPDLDQVLVALDEPPARTINNAPDNRSFKDKWRVQI
FT                   QGCVVAAALCAVITLIAMQWLMAFDAANLVMLYLLGVVVVALFYGRWPSVVATVINVVS
FT                   FDLFFIAPRGTLAVSDVQYLLTFAVMLTVGLVIGNLTAGVRYQARVARYREQRTRHLYE
FT                   MSKALAVGRSPQDIAATSEQFIASTFHARSQVLLPDDNGKLQPLTHPQGMTPWDDAIAQ
FT                   WSFDKGLPAGAGTDTLPGVPYQILPLKSGEKTYGLVVVEPGNLRQLMIPEQQRLLETFT
FT                   LLVANALERLTLTASEEQARMASEREQIRNALLAALSHDLRTPLTVLFGQAEILTLDLA
FT                   SEGSPHARQASEIRQHVLNTTRLVNNLLDMARIQSGGFNLKKEWLTLEEVVGSALQMLE
FT                   PGLSSPINLSLPEPLTLIHVDGPLFERVLINLLENAVKYAGAQAEIGIDAHVEGENLQL
FT                   DVWDNGPGLPPGQEQTIFDKFARGNKESAVPGVGLGLAICRAIVDVHGGTITAFNRPEG
FT                   GACFRVTLPQQTAPELEEFHEDM"
     MNNEPLRPDP DRLLEQTAAP HRGKLKVFFG ACAGVGKTWA MLAEAQRLRA QGLDIVVGVV        60
     ETHGRKDTAA MLEGLAVLPL KRQAYRGRHI SEFDLDAALA RRPALILMDE LAHSNAPGSR       120
     HPKRWQDIEE LLEAGIDVFT TVNVQHLESL NDVVSGVTGI QVRETVPDPF FDAADDVVLV       180
     DLPPDDLRQR LKEGKVYIAG QAERAIEHFF RKGNLIALRE LALRRTADRV DEQMRAWRGH       240
     PGEEKVWHTR DAILLCIGHN TGSEKLVRAA ARLASRLGSV WHAVYVETPA LHRLPEKKRR       300
     AILSALRLAQ ELGAETATLS DPAEEKAVVR YAREHNLGKI ILGRPASRRW WRRETFADRL       360
     ARIAPDLDQV LVALDEPPAR TINNAPDNRS FKDKWRVQIQ GCVVAAALCA VITLIAMQWL       420
     MAFDAANLVM LYLLGVVVVA LFYGRWPSVV ATVINVVSFD LFFIAPRGTL AVSDVQYLLT       480
     FAVMLTVGLV IGNLTAGVRY QARVARYREQ RTRHLYEMSK ALAVGRSPQD IAATSEQFIA       540
     STFHARSQVL LPDDNGKLQP LTHPQGMTPW DDAIAQWSFD KGLPAGAGTD TLPGVPYQIL       600
     PLKSGEKTYG LVVVEPGNLR QLMIPEQQRL LETFTLLVAN ALERLTLTAS EEQARMASER       660
     EQIRNALLAA LSHDLRTPLT VLFGQAEILT LDLASEGSPH ARQASEIRQH VLNTTRLVNN       720
     LLDMARIQSG GFNLKKEWLT LEEVVGSALQ MLEPGLSSPI NLSLPEPLTL IHVDGPLFER       780
     VLINLLENAV KYAGAQAEIG IDAHVEGENL QLDVWDNGPG LPPGQEQTIF DKFARGNKES       840
     AVPGVGLGLA ICRAIVDVHG GTITAFNRPE GGACFRVTLP QQTAPELEEF HEDM             894
//

If you have problems or comments...

PBIL Back to PBIL home page