(data stored in ACNUC7421 zone)

EMBL: CP000948.MAK

CP000948.MAK         Location/Qualifiers
FT   CDS             348699..349607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mak"
FT                   /locus_tag="ECDH10B_0351"
FT                   /product="manno(fructo)kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01523"
FT                   /protein_id="ACB01523.1"
FT                   /translation="MRIGIDLGGTKTEVIALGDAGEQLYRHRLPTPRDDYRQTIETIAT
FT                   LVDMAEQATGQRGTVGMGIPGSISPYTGVVKNANSTWLNGQPFDKDLSARLQREVRLAN
FT                   DANCLAVSEAVDGAAAGAQTVFAVIIGTGCGAGVAFNGRAHIGGNGTAGEWGHNPLPWM
FT                   DEDELRYREEVPCYCGKQGCIETFISGTGFAMDYRRLSGHALKGSEIIRLVEESDPVAE
FT                   LALRRYELRLAKSLAHVVNILDPDVIVLGGGMSNVDRLYQTVGQLIKQFVFGGECETPV
FT                   RKAKHGDSSGVRGAAWLWPQE"
     MRIGIDLGGT KTEVIALGDA GEQLYRHRLP TPRDDYRQTI ETIATLVDMA EQATGQRGTV        60
     GMGIPGSISP YTGVVKNANS TWLNGQPFDK DLSARLQREV RLANDANCLA VSEAVDGAAA       120
     GAQTVFAVII GTGCGAGVAF NGRAHIGGNG TAGEWGHNPL PWMDEDELRY REEVPCYCGK       180
     QGCIETFISG TGFAMDYRRL SGHALKGSEI IRLVEESDPV AELALRRYEL RLAKSLAHVV       240
     NILDPDVIVL GGGMSNVDRL YQTVGQLIKQ FVFGGECETP VRKAKHGDSS GVRGAAWLWP       300
     QE                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page