(data stored in ACNUC7421 zone)

EMBL: CP000948.MATC

CP000948.MATC        Location/Qualifiers
FT   CDS             complement(284132..284800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="matC"
FT                   /gene_synonym="yagY"
FT                   /locus_tag="ECDH10B_0280"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01458"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR040695"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XE34"
FT                   /protein_id="ACB01458.1"
FT                   /translation="MKKHLLPLALLFSGISPAQALDVGDISSFMNSDSSTLSKTIKNST
FT                   DSGRLINIRLERLSSPLDDGQVISMDKPDELLLTPASLLLPAQASEVIRFFYKGPADEK
FT                   ERYYRIVWFDQALSDAQRDNANRSAVATASARIGTILVVAPRQANYHFQYANGSLTNTG
FT                   NATLRILAYGPCLKAANGKECKENYYLMPGKSRRFTRVDTADNKGRVALWQGDKFIPVK
FT                   "
     MKKHLLPLAL LFSGISPAQA LDVGDISSFM NSDSSTLSKT IKNSTDSGRL INIRLERLSS        60
     PLDDGQVISM DKPDELLLTP ASLLLPAQAS EVIRFFYKGP ADEKERYYRI VWFDQALSDA       120
     QRDNANRSAV ATASARIGTI LVVAPRQANY HFQYANGSLT NTGNATLRIL AYGPCLKAAN       180
     GKECKENYYL MPGKSRRFTR VDTADNKGRV ALWQGDKFIP VK                          222
//

If you have problems or comments...

PBIL Back to PBIL home page