(data stored in ACNUC7421 zone)

EMBL: CP000948.MRAZ

CP000948.MRAZ        Location/Qualifiers
FT   CDS             63738..64196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="ECDH10B_0063"
FT                   /product="conserved protein"
FT                   /note="contains two mutations: a synonymous change in codon
FT                   22, and the nonsynonymous change Y41H"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01262"
FT                   /db_xref="GOA:B1XC58"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B1XC58"
FT                   /protein_id="ACB01262.1"
FT                   /translation="MFRGATLVNLDSKGRLSVPTRYREQLLENAAGQMVCTIDIHHPCL
FT                   LLYPLPEWEIIEQKLSRLSSMNPVERRVQRLLLGHASECQMDGAGRLLIAPVLRQHAGL
FT                   TKEVMLVGQFNKFELWDETTWHQQVKEDIDAEQLATGDLSERLQDLSL"
     MFRGATLVNL DSKGRLSVPT RYREQLLENA AGQMVCTIDI HHPCLLLYPL PEWEIIEQKL        60
     SRLSSMNPVE RRVQRLLLGH ASECQMDGAG RLLIAPVLRQ HAGLTKEVML VGQFNKFELW       120
     DETTWHQQVK EDIDAEQLAT GDLSERLQDL SL                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page