(data stored in ACNUC7421 zone)

EMBL: CP000948.MRDB

CP000948.MRDB        Location/Qualifiers
FT   CDS             complement(603756..604868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrdB"
FT                   /locus_tag="ECDH10B_0595"
FT                   /product="cell wall shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01755"
FT                   /protein_id="ACB01755.1"
FT                   /translation="MTDNPNKKTFWDKVHLDPTMLLILLALLVYSALVIWSASGQDIGM
FT                   MERKIGQIAMGLVIMVVMAQIPPRVYEGWAPYLYIICIILLVAVDAFGAISKGAQRWLD
FT                   LGIVRFQPSEIAKIAVPLMVARFINRDVCPPSLKNTGIALVLIFMPTLLVAAQPDLGTS
FT                   ILVALSGLFVLFLSGLSWRLIGVAVVLVAAFIPILWFFLMHDYQRQRVMMLLDPESDPL
FT                   GAGYHIIQSKIAIGSGGLRGKGWLHGTQSQLEFLPERHTDFIFAVLAEELGLVGILILL
FT                   ALYILLIMRGLWIAARAQTTFGRVMAGGLMLILFVYVFVNIGMVSGILPVVGVPLPLVS
FT                   YGGSALIVLMAGFGIVMSIHTHRKMLSKSV"
     MTDNPNKKTF WDKVHLDPTM LLILLALLVY SALVIWSASG QDIGMMERKI GQIAMGLVIM        60
     VVMAQIPPRV YEGWAPYLYI ICIILLVAVD AFGAISKGAQ RWLDLGIVRF QPSEIAKIAV       120
     PLMVARFINR DVCPPSLKNT GIALVLIFMP TLLVAAQPDL GTSILVALSG LFVLFLSGLS       180
     WRLIGVAVVL VAAFIPILWF FLMHDYQRQR VMMLLDPESD PLGAGYHIIQ SKIAIGSGGL       240
     RGKGWLHGTQ SQLEFLPERH TDFIFAVLAE ELGLVGILIL LALYILLIMR GLWIAARAQT       300
     TFGRVMAGGL MLILFVYVFV NIGMVSGILP VVGVPLPLVS YGGSALIVLM AGFGIVMSIH       360
     THRKMLSKSV                                                              370
//

If you have problems or comments...

PBIL Back to PBIL home page