(data stored in ACNUC7421 zone)

EMBL: CP000948.NINE

CP000948.NINE        Location/Qualifiers
FT   CDS             511476..511646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ninE"
FT                   /locus_tag="ECDH10B_0504"
FT                   /product="DLP12 prophage; conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01671"
FT                   /protein_id="ACB01671.1"
FT                   /translation="MATPLIRVMNGHIYRVPNRRKRKPELKPSEIPTLLGYTASLVDKK
FT                   WLRLAARRSHG"
     MATPLIRVMN GHIYRVPNRR KRKPELKPSE IPTLLGYTAS LVDKKWLRLA ARRSHG            56
//

If you have problems or comments...

PBIL Back to PBIL home page