(data stored in ACNUC7421 zone)

EMBL: CP000948.NOHB

CP000948.NOHB        Location/Qualifiers
FT   CDS             519389..519934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nohB"
FT                   /locus_tag="ECDH10B_0518"
FT                   /product="DLP12 prophage; DNA packaging protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01684"
FT                   /protein_id="ACB01684.1"
FT                   /translation="MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAA
FT                   VIKWYAERDAEIENEKLRREVEELLQASETDLQPGTIEYERHRLTRAQADAQELKNARD
FT                   SAEVVETAFCTFVLSRIAGEIASILDGIPLSVQRRFPELENRHVDFLKRDIIKAMNKAA
FT                   ALDELIPGLLSEYIEQSG"
     MEVNKKQLAD IFGASIRTIQ NWQEQGMPVL RGGGKGNEVL YDSAAVIKWY AERDAEIENE        60
     KLRREVEELL QASETDLQPG TIEYERHRLT RAQADAQELK NARDSAEVVE TAFCTFVLSR       120
     IAGEIASILD GIPLSVQRRF PELENRHVDF LKRDIIKAMN KAAALDELIP GLLSEYIEQS       180
     G                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page