(data stored in ACNUC7421 zone)

EMBL: CP000948.OMPT

CP000948.OMPT        Location/Qualifiers
FT   CDS             complement(523235..524188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompT"
FT                   /locus_tag="ECDH10B_0523"
FT                   /product="DLP12 prophage; outer membrane protease VII
FT                   (outer membrane protein 3b)"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01686"
FT                   /protein_id="ACB01686.1"
FT                   /translation="MRAKLLGIVLTTPIAISSFASTETLSFTPDNINADISLGTLSGKT
FT                   KERVYLAEEGGRKVSQLDWKFNNAAIIKGAINWDLMPQISIGAAGWTTLGSRGGNMVDQ
FT                   DWMDSSNPGTWTDESRHPDTQLNYANEFDLNIKGWLLNEPNYRLGLMAGYQESRYSFTA
FT                   RGGSYIYSSEEGFRDDIGSFPNGERAIGYKQRFKMPYIGLTGSYRYEDFELGGTFKYSG
FT                   WVESSDNDEHYDPGKRITYRSKVKDQNYYSVAVNAGYYVTPNAKVYVEGAWNRVTNKKG
FT                   NTSLYDHNNNTSDYSKNGAGIENYNFITTAGLKYTF"
     MRAKLLGIVL TTPIAISSFA STETLSFTPD NINADISLGT LSGKTKERVY LAEEGGRKVS        60
     QLDWKFNNAA IIKGAINWDL MPQISIGAAG WTTLGSRGGN MVDQDWMDSS NPGTWTDESR       120
     HPDTQLNYAN EFDLNIKGWL LNEPNYRLGL MAGYQESRYS FTARGGSYIY SSEEGFRDDI       180
     GSFPNGERAI GYKQRFKMPY IGLTGSYRYE DFELGGTFKY SGWVESSDND EHYDPGKRIT       240
     YRSKVKDQNY YSVAVNAGYY VTPNAKVYVE GAWNRVTNKK GNTSLYDHNN NTSDYSKNGA       300
     GIENYNFITT AGLKYTF                                                      317
//

If you have problems or comments...

PBIL Back to PBIL home page