(data stored in ACNUC7421 zone)

EMBL: CP000948.PE601

CP000948.PE601       Location/Qualifiers
FT   CDS             complement(630999..631409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcV"
FT                   /locus_tag="ECDH10B_0624"
FT                   /product="DLP12 prophage; predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01783"
FT                   /protein_id="ACB01783.1"
FT                   /translation="MAQVAIFKEIFDQVRKDLNCELFYSELKRHNVSHYIYYLATDNIH
FT                   IVLENDNTVLIKGLKKVVNVKFSRNTHLIETSYDRLKSREITFQQYRENLAKAGVFRWI
FT                   TNIHEHKRYYYTFDNSLLFTESIQNTTQIFPR"
     MAQVAIFKEI FDQVRKDLNC ELFYSELKRH NVSHYIYYLA TDNIHIVLEN DNTVLIKGLK        60
     KVVNVKFSRN THLIETSYDR LKSREITFQQ YRENLAKAGV FRWITNIHEH KRYYYTFDNS       120
     LLFTESIQNT TQIFPR                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page