(data stored in ACNUC7421 zone)

EMBL: CP000948.PE603

CP000948.PE603       Location/Qualifiers
FT   CDS             632649..633194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nohB"
FT                   /locus_tag="ECDH10B_0626"
FT                   /product="DLP12 prophage; DNA packaging protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01785"
FT                   /protein_id="ACB01785.1"
FT                   /translation="MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAA
FT                   VIKWYAERDAEIENEKLRREVEELLQASETDLQPGTIEYERHRLTRAQADAQELKNARD
FT                   SAEVVETAFCTFVLSRIAGEIASILDGIPLSVQRRFPELENRHVDFLKRDIIKAMNKAA
FT                   ALDELIPGLLSEYIEQSG"
     MEVNKKQLAD IFGASIRTIQ NWQEQGMPVL RGGGKGNEVL YDSAAVIKWY AERDAEIENE        60
     KLRREVEELL QASETDLQPG TIEYERHRLT RAQADAQELK NARDSAEVVE TAFCTFVLSR       120
     IAGEIASILD GIPLSVQRRF PELENRHVDF LKRDIIKAMN KAAALDELIP GLLSEYIEQS       180
     G                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page