(data stored in ACNUC7421 zone)

EMBL: CP000948.PE610

CP000948.PE610       Location/Qualifiers
FT   CDS             complement(638906..639796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcH"
FT                   /locus_tag="ECDH10B_0633"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01789"
FT                   /protein_id="ACB01789.1"
FT                   /translation="MRKFIFVLLTLLLVSPFSFAMKGIIWQPQNRDSQVTDTQWQGLMS
FT                   QLRLQGFDTLVLQWTRYGDAFTQPEQRTLLFKRAAAAQQAGLKLIVGLNADPEFFMHQK
FT                   QSSAALESYLNRLLAADLQQARLWSAAPGITPDGWYISAEIDDLNWRSEAARQPLLTWL
FT                   NNAQRLISDVSAKPVYISSFFAGNMSPDGYRQLLEHVKATGVNVWVQDGSGVDKLTAEQ
FT                   RERYLQASADCQSPAPASGVVYELFVAGKGKTFTAKPKPDAEIASLLAKRSSCGKDTLY
FT                   FSLRYLPVAHGILEY"
     MRKFIFVLLT LLLVSPFSFA MKGIIWQPQN RDSQVTDTQW QGLMSQLRLQ GFDTLVLQWT        60
     RYGDAFTQPE QRTLLFKRAA AAQQAGLKLI VGLNADPEFF MHQKQSSAAL ESYLNRLLAA       120
     DLQQARLWSA APGITPDGWY ISAEIDDLNW RSEAARQPLL TWLNNAQRLI SDVSAKPVYI       180
     SSFFAGNMSP DGYRQLLEHV KATGVNVWVQ DGSGVDKLTA EQRERYLQAS ADCQSPAPAS       240
     GVVYELFVAG KGKTFTAKPK PDAEIASLLA KRSSCGKDTL YFSLRYLPVA HGILEY           296
//

If you have problems or comments...

PBIL Back to PBIL home page