(data stored in ACNUC7421 zone)

EMBL: CP000948.PE616

CP000948.PE616       Location/Qualifiers
FT   CDS             648946..649278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusF"
FT                   /locus_tag="ECDH10B_0639"
FT                   /product="periplasmic copper-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01795"
FT                   /protein_id="ACB01795.1"
FT                   /translation="MKKALQVAMFSLFTVIGFNAQANEHHHETMSEAQPQVISATGVVK
FT                   GIDLESKKITIHHDPIAAVNWPEMTMRFTITPQTKMSEIKTGDKVAFNFVQQGNLSLLQ
FT                   DIKVSQ"
     MKKALQVAMF SLFTVIGFNA QANEHHHETM SEAQPQVISA TGVVKGIDLE SKKITIHHDP        60
     IAAVNWPEMT MRFTITPQTK MSEIKTGDKV AFNFVQQGNL SLLQDIKVSQ                  110
//

If you have problems or comments...

PBIL Back to PBIL home page