(data stored in ACNUC7421 zone)

EMBL: CP000948.PE622

CP000948.PE622       Location/Qualifiers
FT   CDS             complement(657333..657701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdF"
FT                   /locus_tag="ECDH10B_0645"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01801"
FT                   /protein_id="ACB01801.1"
FT                   /translation="MDKQSLHETAKRLALELPFVELCWPFGPEFDVFKIGGKIFMLSSE
FT                   LRGVPFINLKSDPQKSLLNQQIYPSIKPGYHMNKKHWISVYPGEEISEALLRDLINDSW
FT                   NLVVDGLAKRDQKRVRPG"
     MDKQSLHETA KRLALELPFV ELCWPFGPEF DVFKIGGKIF MLSSELRGVP FINLKSDPQK        60
     SLLNQQIYPS IKPGYHMNKK HWISVYPGEE ISEALLRDLI NDSWNLVVDG LAKRDQKRVR       120
     PG                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page