(data stored in ACNUC7421 zone)

EMBL: CP000948.PE625

CP000948.PE625       Location/Qualifiers
FT   CDS             659651..659803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hokE"
FT                   /locus_tag="ECDH10B_0648"
FT                   /product="toxic polypeptide, small"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01804"
FT                   /protein_id="ACB01804.1"
FT                   /translation="MLTKYALAAVIVLCLTVLGFTLLVGDSLCEFTVKERNIEFKAVLA
FT                   YEPKK"
     MLTKYALAAV IVLCLTVLGF TLLVGDSLCE FTVKERNIEF KAVLAYEPKK                   50
//

If you have problems or comments...

PBIL Back to PBIL home page