(data stored in ACNUC7421 zone)

EMBL: CP000948.PE630

CP000948.PE630       Location/Qualifiers
FT   CDS             665757..665975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdZ"
FT                   /locus_tag="ECDH10B_0653"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01809"
FT                   /protein_id="ACB01809.1"
FT                   /translation="MAFSNPFDDPQGAFYILRNAQGQFSLWPQQCVLPAGWDIVCQPQS
FT                   QASCQQWLEAHWRTLTPTNFTQLQEAQ"
     MAFSNPFDDP QGAFYILRNA QGQFSLWPQQ CVLPAGWDIV CQPQSQASCQ QWLEAHWRTL        60
     TPTNFTQLQE AQ                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page