(data stored in ACNUC7421 zone)

EMBL: CP000948.PE634

CP000948.PE634       Location/Qualifiers
FT   CDS             complement(672011..673003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepG"
FT                   /locus_tag="ECDH10B_0657"
FT                   /product="iron-enterobactin transporter subunit; membrane
FT                   component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01813"
FT                   /protein_id="ACB01813.1"
FT                   /translation="MIYVSRRLLITCLLLVSACVVAGIWGLRSGAVTLETSQVFAALMG
FT                   DAPRSMTMVVTEWRLPRVLMALLIGAALGVSGAIFQSLMRNPLGSPDVMGFNTGAWSGV
FT                   LVAMVLFGQDLTAIALSAMVGGIVTSLLVWLLAWRNGIDTFRLIIIGIGVRAMLVAFNT
FT                   WLLLKASLETALTAGLWNAGSLNGLTWAKTSPSAPIIILMLIAAALLVRRMRLLEMGDD
FT                   TACALGVSVERSRLLMMLVAVVLTAAATALAGPISFIALVAPHIARRISGTARWGLTQA
FT                   ALCGALLLLAADLCAQQLFMPYQLPVGVVTVSLGGIYLIVLLIQESRKK"
     MIYVSRRLLI TCLLLVSACV VAGIWGLRSG AVTLETSQVF AALMGDAPRS MTMVVTEWRL        60
     PRVLMALLIG AALGVSGAIF QSLMRNPLGS PDVMGFNTGA WSGVLVAMVL FGQDLTAIAL       120
     SAMVGGIVTS LLVWLLAWRN GIDTFRLIII GIGVRAMLVA FNTWLLLKAS LETALTAGLW       180
     NAGSLNGLTW AKTSPSAPII ILMLIAAALL VRRMRLLEMG DDTACALGVS VERSRLLMML       240
     VAVVLTAAAT ALAGPISFIA LVAPHIARRI SGTARWGLTQ AALCGALLLL AADLCAQQLF       300
     MPYQLPVGVV TVSLGGIYLI VLLIQESRKK                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page