(data stored in ACNUC7421 zone)

EMBL: CP000948.PE637

CP000948.PE637       Location/Qualifiers
FT   CDS             complement(675369..676325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fepB"
FT                   /locus_tag="ECDH10B_0660"
FT                   /product="iron-enterobactin transporter subunit;
FT                   periplasmic-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01816"
FT                   /protein_id="ACB01816.1"
FT                   /translation="MRLAPLYRNALLLTGLLLSGIAAVQAADWPRQITDSRGTHTLESQ
FT                   PQRIVSTSVTLTGSLLAIDAPVIASGATTPNNRVADDQGFLRQWSKVAKERKLQRLYIG
FT                   EPSAEAVAAQMPDLILISATGGDSALALYDQLSTIAPTLIINYDDKSWQSLLTQLGEIT
FT                   GHEKQAAERIAQFDKQLAAAKEQIKLPPQPVTAIVYTAAAHSANLWTPESAQGQMLEQL
FT                   GFTLAKLPAGLNASQSQGKRHDIIQLGGENLAAGLNGESLFLFAGDQKDADAIYANPLL
FT                   AHLPAVQNKQVYALGTETFRLDYYSAMQVLDRLKALF"
     MRLAPLYRNA LLLTGLLLSG IAAVQAADWP RQITDSRGTH TLESQPQRIV STSVTLTGSL        60
     LAIDAPVIAS GATTPNNRVA DDQGFLRQWS KVAKERKLQR LYIGEPSAEA VAAQMPDLIL       120
     ISATGGDSAL ALYDQLSTIA PTLIINYDDK SWQSLLTQLG EITGHEKQAA ERIAQFDKQL       180
     AAAKEQIKLP PQPVTAIVYT AAAHSANLWT PESAQGQMLE QLGFTLAKLP AGLNASQSQG       240
     KRHDIIQLGG ENLAAGLNGE SLFLFAGDQK DADAIYANPL LAHLPAVQNK QVYALGTETF       300
     RLDYYSAMQV LDRLKALF                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page