(data stored in ACNUC7421 zone)

EMBL: CP000948.PE643

CP000948.PE643       Location/Qualifiers
FT   CDS             681709..683814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cstA"
FT                   /locus_tag="ECDH10B_0666"
FT                   /product="carbon starvation protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01822"
FT                   /protein_id="ACB01822.1"
FT                   /translation="MNKSGKYLVWTVLSVMGAFALGYIALNRGEQINALWIVVASVCIY
FT                   LIAYRFYGLYIAKNVLAVDPTRMTPAVRHNDGLDYVPTDKKVLFGHHFAAIAGAGPLVG
FT                   PVLAAQMGYLPGMIWLLAGVVLAGAVQDFMVLFVSTRRDGRSLGELVKEEMGPTAGVIA
FT                   LVACFMIMVIILAVLAMIVVKALTHSPWGTYTVAFTIPLALFMGIYLRYLRPGRIGEVS
FT                   VIGLVFLIFAIISGGWVAESPTWAPYFDFTGVQLTWMLVGYGFVAAVLPVWLLLAPRDY
FT                   LSTFLKIGTIVGLAVGILIMRPTLTMPALTKFVDGTGPVWTGNLFPFLFITIACGAVSG
FT                   FHALISSGTTPKMLANEGQACFIGYGGMLMESFVAIMALVSACIIDPGVYFAMNSPMAV
FT                   LAPAGTADVVASAAQVVSSWGFSITPDTLNQIASEVGEQSIISRAGGAPTLAVGMAYIL
FT                   HGALGGMMDVAFWYHFAILFEALFILTAVDAGTRAARFMLQDLLGVVSPGLKRTDSLPA
FT                   NLLATALCVLAWGYFLHQGVVDPLGGINTLWPLFGIANQMLAGMALMLCAVVLFKMKRQ
FT                   RYAWVALVPTAWLLICTLTAGWQKAFSPDAKVGFLAIANKFQAMIDSGNIPSQYTESQL
FT                   AQLVFNNRLDAGLTIFFMVVVVVLALFSIKTALAALKDPKPTAKETPYEPMPENVEEIV
FT                   AQAKGAH"
     MNKSGKYLVW TVLSVMGAFA LGYIALNRGE QINALWIVVA SVCIYLIAYR FYGLYIAKNV        60
     LAVDPTRMTP AVRHNDGLDY VPTDKKVLFG HHFAAIAGAG PLVGPVLAAQ MGYLPGMIWL       120
     LAGVVLAGAV QDFMVLFVST RRDGRSLGEL VKEEMGPTAG VIALVACFMI MVIILAVLAM       180
     IVVKALTHSP WGTYTVAFTI PLALFMGIYL RYLRPGRIGE VSVIGLVFLI FAIISGGWVA       240
     ESPTWAPYFD FTGVQLTWML VGYGFVAAVL PVWLLLAPRD YLSTFLKIGT IVGLAVGILI       300
     MRPTLTMPAL TKFVDGTGPV WTGNLFPFLF ITIACGAVSG FHALISSGTT PKMLANEGQA       360
     CFIGYGGMLM ESFVAIMALV SACIIDPGVY FAMNSPMAVL APAGTADVVA SAAQVVSSWG       420
     FSITPDTLNQ IASEVGEQSI ISRAGGAPTL AVGMAYILHG ALGGMMDVAF WYHFAILFEA       480
     LFILTAVDAG TRAARFMLQD LLGVVSPGLK RTDSLPANLL ATALCVLAWG YFLHQGVVDP       540
     LGGINTLWPL FGIANQMLAG MALMLCAVVL FKMKRQRYAW VALVPTAWLL ICTLTAGWQK       600
     AFSPDAKVGF LAIANKFQAM IDSGNIPSQY TESQLAQLVF NNRLDAGLTI FFMVVVVVLA       660
     LFSIKTALAA LKDPKPTAKE TPYEPMPENV EEIVAQAKGA H                           701
//

If you have problems or comments...

PBIL Back to PBIL home page