(data stored in ACNUC7421 zone)

EMBL: CP000948.PE647

CP000948.PE647       Location/Qualifiers
FT   CDS             complement(686562..687191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybdM"
FT                   /locus_tag="ECDH10B_0670"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01826"
FT                   /protein_id="ACB01826.1"
FT                   /translation="MGDTMQQRLTQDLTQFLASLPEDDRIKAINEIRMAIHQVSPFREE
FT                   PVDCVLWVKNSQLMPNDYNPNNVAPPEKKLLQKSIEIDGFTQPIVVTHTDKNAMEIVDG
FT                   FHRHEIGKGSSSLKLRLKGYLPVTCLEGTRNQRIAATIRHNRARGRHQITAMSEIVREL
FT                   SQLGWDDNKIGKELGMDSDEVLRLKQINGLQELFADRQYSRAWTVK"
     MGDTMQQRLT QDLTQFLASL PEDDRIKAIN EIRMAIHQVS PFREEPVDCV LWVKNSQLMP        60
     NDYNPNNVAP PEKKLLQKSI EIDGFTQPIV VTHTDKNAME IVDGFHRHEI GKGSSSLKLR       120
     LKGYLPVTCL EGTRNQRIAA TIRHNRARGR HQITAMSEIV RELSQLGWDD NKIGKELGMD       180
     SDEVLRLKQI NGLQELFADR QYSRAWTVK                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page