(data stored in ACNUC7421 zone)

EMBL: CP000948.PE655

CP000948.PE655       Location/Qualifiers
FT   CDS             complement(695372..695782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnk"
FT                   /locus_tag="ECDH10B_0678"
FT                   /product="regulator of nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01834"
FT                   /protein_id="ACB01834.1"
FT                   /translation="MSRPTIIINDLDAERIDILLEQPAYAGLPIADALNAELDRAQMCS
FT                   PEEMPHDVVTMNSRVKFRNLSDGEVRVRTLVYPAKMTDSNTQLSVMAPVGAALLGLRVG
FT                   DSIHWELPGGVATHLEVLELEYQPEAAGDYLL"
     MSRPTIIIND LDAERIDILL EQPAYAGLPI ADALNAELDR AQMCSPEEMP HDVVTMNSRV        60
     KFRNLSDGEV RVRTLVYPAK MTDSNTQLSV MAPVGAALLG LRVGDSIHWE LPGGVATHLE       120
     VLELEYQPEA AGDYLL                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page