(data stored in ACNUC7421 zone)

EMBL: CP000948.PE669

CP000948.PE669       Location/Qualifiers
FT   CDS             complement(709370..709753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crcB"
FT                   /locus_tag="ECDH10B_0692"
FT                   /product="predicted inner membrane protein associated with
FT                   chromosome condensation"
FT                   /db_xref="EnsemblGenomes-Gn:ECDH10B_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACB01848"
FT                   /protein_id="ACB01848.1"
FT                   /translation="MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGA
FT                   FIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVF
FT                   VNLLGSFAMTALAFWLFSASTAH"
     MLQLLLAVFI GGGTGSVARW LLSMRFNPLH QAIPLGTLTA NLIGAFIIGI GFAWFSRMTN        60
     IDPVWKVLIT TGFCGGLTTF STFSAEVVFL LQEGRFGWAL LNVFVNLLGS FAMTALAFWL       120
     FSASTAH                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page